eF-site ID 1mfr-P PDB Code 1mfr Chain P click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence P:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain P residue 23 type sequence E description BINDING SITE FOR RESIDUE MG P 176 source : DC4 2) chain P residue 58 type sequence E description BINDING SITE FOR RESIDUE MG P 176 source : DC4 3) chain P residue 61 type sequence H description BINDING SITE FOR RESIDUE MG P 176 source : DC4 4) chain P residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG P 176 source : DC4 5) chain P residue 58 type sequence E description BINDING SITE FOR RESIDUE MG P 177 source : DC5 6) chain P residue 103 type sequence E description BINDING SITE FOR RESIDUE MG P 177 source : DC5 7) chain P residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG P 177 source : DC5 8) chain P residue 140 type sequence D description BINDING SITE FOR RESIDUE MG P 177 source : DC5 9) chain P residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain P residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain P residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain P residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain P residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain P residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links