eF-site ID 1mfr-M PDB Code 1mfr Chain M click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence M:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain M residue 23 type sequence E description BINDING SITE FOR RESIDUE MG M 176 source : CC7 2) chain M residue 58 type sequence E description BINDING SITE FOR RESIDUE MG M 176 source : CC7 3) chain M residue 61 type sequence H description BINDING SITE FOR RESIDUE MG M 176 source : CC7 4) chain M residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG M 176 source : CC7 5) chain M residue 58 type sequence E description BINDING SITE FOR RESIDUE MG M 177 source : CC8 6) chain M residue 103 type sequence E description BINDING SITE FOR RESIDUE MG M 177 source : CC8 7) chain M residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG M 177 source : CC8 8) chain M residue 140 type sequence D description BINDING SITE FOR RESIDUE MG M 177 source : CC8 9) chain M residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain M residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain M residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain M residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain M residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain M residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links