eF-site ID 1mfr-K PDB Code 1mfr Chain K click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence K:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain K residue 23 type sequence E description BINDING SITE FOR RESIDUE MG K 176 source : CC3 2) chain K residue 58 type sequence E description BINDING SITE FOR RESIDUE MG K 176 source : CC3 3) chain K residue 61 type sequence H description BINDING SITE FOR RESIDUE MG K 176 source : CC3 4) chain K residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG K 176 source : CC3 5) chain K residue 58 type sequence E description BINDING SITE FOR RESIDUE MG K 177 source : CC4 6) chain K residue 103 type sequence E description BINDING SITE FOR RESIDUE MG K 177 source : CC4 7) chain K residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG K 177 source : CC4 8) chain K residue 140 type sequence D description BINDING SITE FOR RESIDUE MG K 177 source : CC4 9) chain K residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain K residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain K residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain K residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain K residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain K residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links