eF-site ID 1mfr-J PDB Code 1mfr Chain J click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence J:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain J residue 23 type sequence E description BINDING SITE FOR RESIDUE MG J 176 source : CC1 2) chain J residue 58 type sequence E description BINDING SITE FOR RESIDUE MG J 176 source : CC1 3) chain J residue 61 type sequence H description BINDING SITE FOR RESIDUE MG J 176 source : CC1 4) chain J residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG J 176 source : CC1 5) chain J residue 58 type sequence E description BINDING SITE FOR RESIDUE MG J 177 source : CC2 6) chain J residue 103 type sequence E description BINDING SITE FOR RESIDUE MG J 177 source : CC2 7) chain J residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG J 177 source : CC2 8) chain J residue 140 type sequence D description BINDING SITE FOR RESIDUE MG J 177 source : CC2 9) chain J residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain J residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain J residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain J residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain J residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain J residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links