eF-site ID 1mfr-E PDB Code 1mfr Chain E click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source null (FRI2_RANCA) Sequence E:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain E residue 23 type sequence E description BINDING SITE FOR RESIDUE MG E 176 source : AC9 2) chain E residue 58 type sequence E description BINDING SITE FOR RESIDUE MG E 176 source : AC9 3) chain E residue 61 type sequence H description BINDING SITE FOR RESIDUE MG E 176 source : AC9 4) chain E residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG E 176 source : AC9 5) chain E residue 58 type sequence E description BINDING SITE FOR RESIDUE MG E 177 source : BC1 6) chain E residue 103 type sequence E description BINDING SITE FOR RESIDUE MG E 177 source : BC1 7) chain E residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG E 177 source : BC1 8) chain E residue 140 type sequence D description BINDING SITE FOR RESIDUE MG E 177 source : BC1 9) chain E residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain E residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain E residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain E residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain E residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 14) chain E residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links