eF-site ID 1mfr-A PDB Code 1mfr Chain A click to enlarge Title CRYSTAL STRUCTURE OF M FERRITIN Classification IRON STORAGE Compound M FERRITIN Source Rana catesbeiana (American bullfrog) (Lithobates catesbeiana) (FRI2_RANCA) Sequence A:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD DVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSV Description Functional site 1) chain A residue 23 type sequence E description BINDING SITE FOR RESIDUE MG A 176 source : AC1 2) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE MG A 176 source : AC1 3) chain A residue 61 type sequence H description BINDING SITE FOR RESIDUE MG A 176 source : AC1 4) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG A 176 source : AC1 5) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE MG A 177 source : AC2 6) chain A residue 103 type sequence E description BINDING SITE FOR RESIDUE MG A 177 source : AC2 7) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG A 177 source : AC2 8) chain A residue 140 type sequence D description BINDING SITE FOR RESIDUE MG A 177 source : AC2 9) chain A residue 122-142 type prosite sequence DPHLCDFLESEYLEEQVKDIK description FERRITIN_2 Ferritin iron-binding regions signature 2. DphLCDFLEseYLeeqvkdIK source prosite : PS00204 10) chain A residue 57-75 type prosite sequence EEREHAEKFMKYQNKRGGR description FERRITIN_1 Ferritin iron-binding regions signature 1. EeREhaEKFMkyQNkRgGR source prosite : PS00540 11) chain A residue 23 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 58 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 61 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 103 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 137 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 140 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links