eF-site ID 1mew-A PDB Code 1mew Chain A click to enlarge Title Inosine Monophosphate Dehydrogenase (IMPDH) From Tritrichomonas Foetus with XMP and NAD bound Classification OXIDOREDUCTASE Compound INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE Source null (IMDH_TRIFO) Sequence A:  AKYYNEPCHTFNEYLLIPGLSTVDCIPSNVNLSTPLVKFQ KGQQSEINLKIPLVSAIMQSVSGEKMAIALAREGGISFIF GSQSIESQAAMVHAVKNFKAHNELVDSQKRYLVGAGINTR DFRERVPALVEAGADVLCIDSSDGFSEWQKITIGWIREKY GDKVKVGAGNIVDGEGFRYLADAGADFIKIGIGGGSREQK GIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDY HMTLALAMGADFIMLGRYFARFEESPTRKVTINGSVMKEY WGEGSSRARNWEGVDSYVPYAGKLKDNVEASLNKVKSTMC NCGALTIPQLQSKAKITLVSSVSI Description (1)  INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE (E.C.1.1.1.205) Functional site 1) chain A residue 20 type sequence G description BINDING SITE FOR RESIDUE K A 900 source : AC1 2) chain A residue 22 type sequence S description BINDING SITE FOR RESIDUE K A 900 source : AC1 3) chain A residue 264 type sequence D description BINDING SITE FOR RESIDUE K A 900 source : AC1 4) chain A residue 266 type sequence F description BINDING SITE FOR RESIDUE K A 900 source : AC1 5) chain A residue 460 type sequence N description BINDING SITE FOR RESIDUE K A 900 source : AC1 6) chain A residue 57 type sequence A description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 7) chain A residue 316 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 8) chain A residue 317 type sequence S description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 9) chain A residue 358 type sequence D description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 10) chain A residue 360 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 11) chain A residue 379 type sequence M description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 12) chain A residue 380 type sequence L description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 13) chain A residue 381 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 14) chain A residue 382 type sequence R description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 15) chain A residue 405 type sequence Y description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 16) chain A residue 407 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 17) chain A residue 408 type sequence E description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 18) chain A residue 409 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 19) chain A residue 431 type sequence E description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 20) chain A residue 432 type sequence G description BINDING SITE FOR RESIDUE XMP A 602 source : AC2 21) chain A residue 240 type sequence T description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 22) chain A residue 241 type sequence R description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 23) chain A residue 261 type sequence D description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 24) chain A residue 262 type sequence S description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 25) chain A residue 263 type sequence S description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 26) chain A residue 269 type sequence W description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 27) chain A residue 312 type sequence G description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 28) chain A residue 313 type sequence I description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 29) chain A residue 314 type sequence G description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 30) chain A residue 408 type sequence E description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 31) chain A residue 409 type sequence G description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 32) chain A residue 431 type sequence E description BINDING SITE FOR RESIDUE NAD A 987 source : AC3 33) chain A residue 22 type BINDING sequence S description in other chain => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 314 type BINDING sequence G description in other chain => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 316 type BINDING sequence G description in other chain => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 460 type BINDING sequence N description in other chain => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI3 37) chain A residue 20 type BINDING sequence G description in other chain => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI3 38) chain A residue 312 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI4 39) chain A residue 317 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI4 40) chain A residue 358 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI4 41) chain A residue 381 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI4 42) chain A residue 405 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI4 43) chain A residue 431 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI4 44) chain A residue 261 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI4 45) chain A residue 264 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI5 46) chain A residue 266 type BINDING sequence F description BINDING => ECO:0000269|PubMed:12549902 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links