eF-site ID 1mco-L
PDB Code 1mco
Chain L

click to enlarge
Title THREE-DIMENSIONAL STRUCTURE OF A HUMAN IMMUNOGLOBULIN WITH A HINGE DELETION
Classification IMMUNOGLOBULIN
Compound IGG1 MCG INTACT ANTIBODY (LIGHT CHAIN)
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence L:  PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQ
HAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGL
QAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATEVCLISDFYPGAVTVAWKADGSPVK
AGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPTECS
Description (1)  IMMUNOGLOBULIN G1 (IGG1) (MCG) WITH A HINGE DELETION


Functional site

1) chain L
residue 23
type
ligand
sequence T
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

2) chain L
residue 24
type
ligand
sequence G
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

3) chain L
residue 25
type
ligand
sequence T
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

4) chain L
residue 26
type
ligand
sequence S
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

5) chain L
residue 27
type
ligand
sequence S
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

6) chain L
residue 28
type
ligand
sequence D
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

7) chain L
residue 29
type
ligand
sequence V
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

8) chain L
residue 30
type
ligand
sequence G
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

9) chain L
residue 31
type
ligand
sequence G
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

10) chain L
residue 32
type
ligand
sequence Y
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

11) chain L
residue 33
type
ligand
sequence N
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

12) chain L
residue 34
type
ligand
sequence Y
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

13) chain L
residue 35
type
ligand
sequence V
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

14) chain L
residue 36
type
ligand
sequence S
description ANTIGEN COMBINING SITE 1 IN CHAIN L
source : LC1

15) chain L
residue 52
type
ligand
sequence E
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

16) chain L
residue 53
type
ligand
sequence V
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

17) chain L
residue 54
type
ligand
sequence N
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

18) chain L
residue 55
type
ligand
sequence K
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

19) chain L
residue 56
type
ligand
sequence R
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

20) chain L
residue 57
type
ligand
sequence P
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

21) chain L
residue 58
type
ligand
sequence S
description ANTIGEN COMBINING SITE 2 IN CHAIN L
source : LC2

22) chain L
residue 91
type
ligand
sequence S
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

23) chain L
residue 92
type
ligand
sequence S
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

24) chain L
residue 93
type
ligand
sequence Y
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

25) chain L
residue 94
type
ligand
sequence E
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

26) chain L
residue 95
type
ligand
sequence G
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

27) chain L
residue 96
type
ligand
sequence S
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

28) chain L
residue 97
type
ligand
sequence D
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

29) chain L
residue 98
type
ligand
sequence N
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

30) chain L
residue 99
type
ligand
sequence F
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3

31) chain L
residue 100
type
ligand
sequence V
description ANTIGEN COMBINING SITE 3 IN CHAIN L
source : LC3


Display surface

Download
Links