eF-site ID 1mb1-A
PDB Code 1mb1
Chain A

click to enlarge
Title MBP1 FROM SACCHAROMYCES CEREVISIAE
Classification TRANSCRIPTION REGULATION
Compound MLU1-BOX BINDING PROTEIN
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (MBP1_YEAST)
Sequence A:  NQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKA
ANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNI
AKQLAEKFSVYDQLKPLF
Description (1)  MLU1-BOX BINDING PROTEIN


Functional site

1) chain A
residue 36-57
type DNA_BIND
ligand
sequence ATHILKAANFAKAKRTRILEKE
description H-T-H motif.
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links