eF-site ID 1m9d-B PDB Code 1m9d Chain B click to enlarge Title X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) O-type chimera Complex. Classification Isomerase/Viral protein Compound Cyclophilin A Source Homo sapiens (Human) (Q72497_9HIV1) Sequence B:  NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTG EKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEK FEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWL DGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCG QLE Description Functional site 1) chain B residue 55 type catalytic sequence R description 189 source MCSA : MCSA2 2) chain B residue 60 type catalytic sequence F description 189 source MCSA : MCSA2 3) chain B residue 63 type catalytic sequence Q description 189 source MCSA : MCSA2 4) chain B residue 102 type catalytic sequence N description 189 source MCSA : MCSA2 5) chain B residue 113 type catalytic sequence F description 189 source MCSA : MCSA2 6) chain B residue 122 type catalytic sequence L description 189 source MCSA : MCSA2 7) chain B residue 126 type catalytic sequence H description 189 source MCSA : MCSA2 8) chain B residue 125 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:20364129, ECO:0000269|PubMed:25678563, ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI7 9) chain B residue 44 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 10) chain B residue 76 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 11) chain B residue 131 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 12) chain B residue 133 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P17742 source Swiss-Prot : SWS_FT_FI8 13) chain B residue 108 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI9 14) chain B residue 28 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate source Swiss-Prot : SWS_FT_FI10 15) chain B residue 82 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI11 16) chain B residue 28 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 17) chain B residue 82 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 18) chain B residue 77 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI5 19) chain B residue 93 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links