eF-site ID 1m8v-M PDB Code 1m8v Chain M click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source Pyrococcus abyssi (strain GE5 / Orsay) (1M8V) Sequence M:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT Description Functional site 1) chain M residue 663 type sequence R description BINDING SITE FOR RESIDUE U L 421 source : CC1 2) chain M residue 637 type sequence H description BINDING SITE FOR RESIDUE U M 422 source : CC2 3) chain M residue 639 type sequence N description BINDING SITE FOR RESIDUE U M 422 source : CC2 4) chain M residue 663 type sequence R description BINDING SITE FOR RESIDUE U M 422 source : CC2 5) chain M residue 665 type sequence D description BINDING SITE FOR RESIDUE U M 422 source : CC2 6) chain M residue 622 type sequence K description BINDING SITE FOR RESIDUE U M 423 source : CC3 7) chain M residue 638 type sequence L description BINDING SITE FOR RESIDUE U M 423 source : CC3 8) chain M residue 665 type sequence D description BINDING SITE FOR RESIDUE U M 423 source : CC3

Display surface Download Links