eF-site ID 1m8v-K PDB Code 1m8v Chain K click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source Pyrococcus abyssi (strain GE5 / Orsay) (1M8V) Sequence K:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT Description Functional site 1) chain K residue 463 type sequence R description BINDING SITE FOR RESIDUE U J 419 source : BC8 2) chain K residue 437 type sequence H description BINDING SITE FOR RESIDUE U K 476 source : BC9 3) chain K residue 439 type sequence N description BINDING SITE FOR RESIDUE U K 476 source : BC9 4) chain K residue 463 type sequence R description BINDING SITE FOR RESIDUE U K 476 source : BC9 5) chain K residue 464 type sequence G description BINDING SITE FOR RESIDUE U K 476 source : BC9 6) chain K residue 465 type sequence D description BINDING SITE FOR RESIDUE U K 476 source : BC9 7) chain K residue 437 type sequence H description BINDING SITE FOR RESIDUE U L 421 source : CC1 8) chain K residue 438 type sequence L description BINDING SITE FOR RESIDUE U L 421 source : CC1

Display surface Download Links