eF-site ID 1m8v-J PDB Code 1m8v Chain J click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source null (1M8V) Sequence J:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT Description Functional site 1) chain J residue 363 type sequence R description BINDING SITE FOR RESIDUE U I 418 source : BC7 2) chain J residue 339 type sequence N description BINDING SITE FOR RESIDUE U J 419 source : BC8 3) chain J residue 363 type sequence R description BINDING SITE FOR RESIDUE U J 419 source : BC8 4) chain J residue 364 type sequence G description BINDING SITE FOR RESIDUE U J 419 source : BC8 5) chain J residue 365 type sequence D description BINDING SITE FOR RESIDUE U J 419 source : BC8 6) chain J residue 338 type sequence L description BINDING SITE FOR RESIDUE U K 476 source : BC9

Display surface Download Links