eF-site ID 1m8v-I PDB Code 1m8v Chain I click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source Pyrococcus abyssi (strain GE5 / Orsay) (1M8V) Sequence I:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT Description Functional site 1) chain I residue 263 type sequence R description BINDING SITE FOR RESIDUE U H 417 source : BC6 2) chain I residue 237 type sequence H description BINDING SITE FOR RESIDUE U I 418 source : BC7 3) chain I residue 239 type sequence N description BINDING SITE FOR RESIDUE U I 418 source : BC7 4) chain I residue 263 type sequence R description BINDING SITE FOR RESIDUE U I 418 source : BC7 5) chain I residue 265 type sequence D description BINDING SITE FOR RESIDUE U I 418 source : BC7 6) chain I residue 238 type sequence L description BINDING SITE FOR RESIDUE U J 419 source : BC8

Display surface Download Links