eF-site ID 1m8v-D PDB Code 1m8v Chain D click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source Pyrococcus abyssi (strain GE5 / Orsay) (1M8V) Sequence D:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT Description Functional site 1) chain D residue 463 type sequence R description BINDING SITE FOR RESIDUE U C 412 source : BC1 2) chain D residue 437 type sequence H description BINDING SITE FOR RESIDUE U D 476 source : BC2 3) chain D residue 439 type sequence N description BINDING SITE FOR RESIDUE U D 476 source : BC2 4) chain D residue 463 type sequence R description BINDING SITE FOR RESIDUE U D 476 source : BC2 5) chain D residue 464 type sequence G description BINDING SITE FOR RESIDUE U D 476 source : BC2 6) chain D residue 465 type sequence D description BINDING SITE FOR RESIDUE U D 476 source : BC2 7) chain D residue 437 type sequence H description BINDING SITE FOR RESIDUE U E 414 source : BC3 8) chain D residue 438 type sequence L description BINDING SITE FOR RESIDUE U E 414 source : BC3

Display surface Download Links