eF-site ID 1m8v-ABCDEFGHIJKLMNOPQRSTU PDB Code 1m8v Chain A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U click to enlarge Title Structure of Pyrococcus abyssii Sm Protein in Complex with a Uridine Heptamer Classification RNA BINDING PROTEIN/RNA Compound 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3' Source Pyrococcus abyssi (strain GE5 / Orsay) (1M8V) Sequence A:  AERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVV LADAEMIQDGEVVKRYGKIVIRGDNVLAISPT B:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT C:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT D:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT E:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT F:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT G:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT H:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT I:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT J:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT K:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT L:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT M:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT N:  ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVL ADAEMIQDGEVVKRYGKIVIRGDNVLAISPT O:  UUUUUU P:  UUUUUU Q:  UUUUUU R:  UUUUUU S:  UUUUUU T:  UUUUU U:  UUUUUU Description Functional site 1) chain O residue 2 type sequence U description BINDING SITE FOR RESIDUE CA O 310 source : AC1 2) chain O residue 3 type sequence U description BINDING SITE FOR RESIDUE CA O 310 source : AC1 3) chain O residue 4 type sequence U description BINDING SITE FOR RESIDUE CA O 310 source : AC1 4) chain O residue 5 type sequence U description BINDING SITE FOR RESIDUE CA O 310 source : AC1 5) chain O residue 6 type sequence U description BINDING SITE FOR RESIDUE CA O 310 source : AC1 6) chain T residue 2 type sequence U description BINDING SITE FOR RESIDUE CA T 320 source : AC2 7) chain T residue 3 type sequence U description BINDING SITE FOR RESIDUE CA T 320 source : AC2 8) chain T residue 5 type sequence U description BINDING SITE FOR RESIDUE CA T 320 source : AC2 9) chain P residue 2 type sequence U description BINDING SITE FOR RESIDUE CA P 330 source : AC3 10) chain P residue 3 type sequence U description BINDING SITE FOR RESIDUE CA P 330 source : AC3 11) chain P residue 5 type sequence U description BINDING SITE FOR RESIDUE CA P 330 source : AC3 12) chain P residue 6 type sequence U description BINDING SITE FOR RESIDUE CA P 330 source : AC3 13) chain S residue 2 type sequence U description BINDING SITE FOR RESIDUE CA S 340 source : AC4 14) chain S residue 3 type sequence U description BINDING SITE FOR RESIDUE CA S 340 source : AC4 15) chain S residue 5 type sequence U description BINDING SITE FOR RESIDUE CA S 340 source : AC4 16) chain S residue 6 type sequence U description BINDING SITE FOR RESIDUE CA S 340 source : AC4 17) chain U residue 2 type sequence U description BINDING SITE FOR RESIDUE CA U 370 source : AC5 18) chain U residue 3 type sequence U description BINDING SITE FOR RESIDUE CA U 370 source : AC5 19) chain U residue 5 type sequence U description BINDING SITE FOR RESIDUE CA U 370 source : AC5 20) chain U residue 6 type sequence U description BINDING SITE FOR RESIDUE CA U 370 source : AC5 21) chain Q residue 2 type sequence U description BINDING SITE FOR RESIDUE CA Q 380 source : AC6 22) chain Q residue 3 type sequence U description BINDING SITE FOR RESIDUE CA Q 380 source : AC6 23) chain Q residue 5 type sequence U description BINDING SITE FOR RESIDUE CA Q 380 source : AC6 24) chain Q residue 6 type sequence U description BINDING SITE FOR RESIDUE CA Q 380 source : AC6 25) chain R residue 2 type sequence U description BINDING SITE FOR RESIDUE CA R 390 source : AC7 26) chain R residue 3 type sequence U description BINDING SITE FOR RESIDUE CA R 390 source : AC7 27) chain R residue 5 type sequence U description BINDING SITE FOR RESIDUE CA R 390 source : AC7 28) chain R residue 6 type sequence U description BINDING SITE FOR RESIDUE CA R 390 source : AC7 29) chain A residue 137 type sequence H description BINDING SITE FOR RESIDUE U A 410 source : AC8 30) chain A residue 139 type sequence N description BINDING SITE FOR RESIDUE U A 410 source : AC8 31) chain A residue 163 type sequence R description BINDING SITE FOR RESIDUE U A 410 source : AC8 32) chain A residue 164 type sequence G description BINDING SITE FOR RESIDUE U A 410 source : AC8 33) chain A residue 165 type sequence D description BINDING SITE FOR RESIDUE U A 410 source : AC8 34) chain B residue 263 type sequence R description BINDING SITE FOR RESIDUE U A 410 source : AC8 35) chain G residue 738 type sequence L description BINDING SITE FOR RESIDUE U A 410 source : AC8 36) chain A residue 138 type sequence L description BINDING SITE FOR RESIDUE U B 411 source : AC9 37) chain B residue 237 type sequence H description BINDING SITE FOR RESIDUE U B 411 source : AC9 38) chain B residue 239 type sequence N description BINDING SITE FOR RESIDUE U B 411 source : AC9 39) chain B residue 263 type sequence R description BINDING SITE FOR RESIDUE U B 411 source : AC9 40) chain B residue 264 type sequence G description BINDING SITE FOR RESIDUE U B 411 source : AC9 41) chain B residue 265 type sequence D description BINDING SITE FOR RESIDUE U B 411 source : AC9 42) chain B residue 236 type sequence I description BINDING SITE FOR RESIDUE U C 412 source : BC1 43) chain B residue 238 type sequence L description BINDING SITE FOR RESIDUE U C 412 source : BC1 44) chain C residue 337 type sequence H description BINDING SITE FOR RESIDUE U C 412 source : BC1 45) chain C residue 339 type sequence N description BINDING SITE FOR RESIDUE U C 412 source : BC1 46) chain C residue 363 type sequence R description BINDING SITE FOR RESIDUE U C 412 source : BC1 47) chain C residue 364 type sequence G description BINDING SITE FOR RESIDUE U C 412 source : BC1 48) chain C residue 365 type sequence D description BINDING SITE FOR RESIDUE U C 412 source : BC1 49) chain D residue 463 type sequence R description BINDING SITE FOR RESIDUE U C 412 source : BC1 50) chain C residue 338 type sequence L description BINDING SITE FOR RESIDUE U D 476 source : BC2 51) chain D residue 437 type sequence H description BINDING SITE FOR RESIDUE U D 476 source : BC2 52) chain D residue 439 type sequence N description BINDING SITE FOR RESIDUE U D 476 source : BC2 53) chain D residue 463 type sequence R description BINDING SITE FOR RESIDUE U D 476 source : BC2 54) chain D residue 464 type sequence G description BINDING SITE FOR RESIDUE U D 476 source : BC2 55) chain D residue 465 type sequence D description BINDING SITE FOR RESIDUE U D 476 source : BC2 56) chain E residue 563 type sequence R description BINDING SITE FOR RESIDUE U D 476 source : BC2 57) chain D residue 437 type sequence H description BINDING SITE FOR RESIDUE U E 414 source : BC3 58) chain D residue 438 type sequence L description BINDING SITE FOR RESIDUE U E 414 source : BC3 59) chain E residue 539 type sequence N description BINDING SITE FOR RESIDUE U E 414 source : BC3 60) chain E residue 563 type sequence R description BINDING SITE FOR RESIDUE U E 414 source : BC3 61) chain E residue 565 type sequence D description BINDING SITE FOR RESIDUE U E 414 source : BC3 62) chain F residue 663 type sequence R description BINDING SITE FOR RESIDUE U E 414 source : BC3 63) chain E residue 537 type sequence H description BINDING SITE FOR RESIDUE U F 415 source : BC4 64) chain E residue 538 type sequence L description BINDING SITE FOR RESIDUE U F 415 source : BC4 65) chain F residue 637 type sequence H description BINDING SITE FOR RESIDUE U F 415 source : BC4 66) chain F residue 639 type sequence N description BINDING SITE FOR RESIDUE U F 415 source : BC4 67) chain F residue 663 type sequence R description BINDING SITE FOR RESIDUE U F 415 source : BC4 68) chain F residue 664 type sequence G description BINDING SITE FOR RESIDUE U F 415 source : BC4 69) chain F residue 665 type sequence D description BINDING SITE FOR RESIDUE U F 415 source : BC4 70) chain G residue 763 type sequence R description BINDING SITE FOR RESIDUE U F 415 source : BC4 71) chain F residue 638 type sequence L description BINDING SITE FOR RESIDUE U G 416 source : BC5 72) chain G residue 737 type sequence H description BINDING SITE FOR RESIDUE U G 416 source : BC5 73) chain G residue 739 type sequence N description BINDING SITE FOR RESIDUE U G 416 source : BC5 74) chain G residue 763 type sequence R description BINDING SITE FOR RESIDUE U G 416 source : BC5 75) chain G residue 765 type sequence D description BINDING SITE FOR RESIDUE U G 416 source : BC5 76) chain H residue 137 type sequence H description BINDING SITE FOR RESIDUE U H 417 source : BC6 77) chain H residue 139 type sequence N description BINDING SITE FOR RESIDUE U H 417 source : BC6 78) chain H residue 163 type sequence R description BINDING SITE FOR RESIDUE U H 417 source : BC6 79) chain H residue 165 type sequence D description BINDING SITE FOR RESIDUE U H 417 source : BC6 80) chain I residue 263 type sequence R description BINDING SITE FOR RESIDUE U H 417 source : BC6 81) chain N residue 738 type sequence L description BINDING SITE FOR RESIDUE U H 417 source : BC6 82) chain H residue 138 type sequence L description BINDING SITE FOR RESIDUE U I 418 source : BC7 83) chain I residue 237 type sequence H description BINDING SITE FOR RESIDUE U I 418 source : BC7 84) chain I residue 239 type sequence N description BINDING SITE FOR RESIDUE U I 418 source : BC7 85) chain I residue 263 type sequence R description BINDING SITE FOR RESIDUE U I 418 source : BC7 86) chain I residue 265 type sequence D description BINDING SITE FOR RESIDUE U I 418 source : BC7 87) chain J residue 363 type sequence R description BINDING SITE FOR RESIDUE U I 418 source : BC7 88) chain I residue 238 type sequence L description BINDING SITE FOR RESIDUE U J 419 source : BC8 89) chain J residue 339 type sequence N description BINDING SITE FOR RESIDUE U J 419 source : BC8 90) chain J residue 363 type sequence R description BINDING SITE FOR RESIDUE U J 419 source : BC8 91) chain J residue 364 type sequence G description BINDING SITE FOR RESIDUE U J 419 source : BC8 92) chain J residue 365 type sequence D description BINDING SITE FOR RESIDUE U J 419 source : BC8 93) chain K residue 463 type sequence R description BINDING SITE FOR RESIDUE U J 419 source : BC8 94) chain J residue 338 type sequence L description BINDING SITE FOR RESIDUE U K 476 source : BC9 95) chain K residue 437 type sequence H description BINDING SITE FOR RESIDUE U K 476 source : BC9 96) chain K residue 439 type sequence N description BINDING SITE FOR RESIDUE U K 476 source : BC9 97) chain K residue 463 type sequence R description BINDING SITE FOR RESIDUE U K 476 source : BC9 98) chain K residue 464 type sequence G description BINDING SITE FOR RESIDUE U K 476 source : BC9 99) chain K residue 465 type sequence D description BINDING SITE FOR RESIDUE U K 476 source : BC9 100) chain L residue 563 type sequence R description BINDING SITE FOR RESIDUE U K 476 source : BC9 101) chain K residue 437 type sequence H description BINDING SITE FOR RESIDUE U L 421 source : CC1 102) chain K residue 438 type sequence L description BINDING SITE FOR RESIDUE U L 421 source : CC1 103) chain L residue 537 type sequence H description BINDING SITE FOR RESIDUE U L 421 source : CC1 104) chain L residue 539 type sequence N description BINDING SITE FOR RESIDUE U L 421 source : CC1 105) chain L residue 563 type sequence R description BINDING SITE FOR RESIDUE U L 421 source : CC1 106) chain L residue 565 type sequence D description BINDING SITE FOR RESIDUE U L 421 source : CC1 107) chain M residue 663 type sequence R description BINDING SITE FOR RESIDUE U L 421 source : CC1 108) chain L residue 538 type sequence L description BINDING SITE FOR RESIDUE U M 422 source : CC2 109) chain M residue 637 type sequence H description BINDING SITE FOR RESIDUE U M 422 source : CC2 110) chain M residue 639 type sequence N description BINDING SITE FOR RESIDUE U M 422 source : CC2 111) chain M residue 663 type sequence R description BINDING SITE FOR RESIDUE U M 422 source : CC2 112) chain M residue 665 type sequence D description BINDING SITE FOR RESIDUE U M 422 source : CC2 113) chain M residue 622 type sequence K description BINDING SITE FOR RESIDUE U M 423 source : CC3 114) chain M residue 638 type sequence L description BINDING SITE FOR RESIDUE U M 423 source : CC3 115) chain M residue 665 type sequence D description BINDING SITE FOR RESIDUE U M 423 source : CC3 116) chain N residue 737 type sequence H description BINDING SITE FOR RESIDUE U M 423 source : CC3 117) chain N residue 739 type sequence N description BINDING SITE FOR RESIDUE U M 423 source : CC3 118) chain N residue 763 type sequence R description BINDING SITE FOR RESIDUE U M 423 source : CC3 119) chain N residue 765 type sequence D description BINDING SITE FOR RESIDUE U M 423 source : CC3

Display surface Download Links