eF-site ID 1m70-D PDB Code 1m70 Chain D click to enlarge Title Crystal structure of oxidized recombinant cytochrome c4 from Pseudomonas stutzeri Classification ELECTRON TRANSPORT Compound Cytochrome c4 Source null (CYC4_PSEST) Sequence D:  AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYL LKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLED IAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACT GCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTN DGDTMIMRGVAAKLSNKDIEALSSYIQGLH Description Functional site 1) chain D residue 16 type sequence A description BINDING SITE FOR RESIDUE HEC B 200 source : AC4 2) chain D residue 13 type sequence V description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 3) chain D residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 4) chain D residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 5) chain D residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 6) chain D residue 29 type sequence F description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 7) chain D residue 30 type sequence P description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 8) chain D residue 39 type sequence Y description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 9) chain D residue 43 type sequence Q description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 10) chain D residue 44 type sequence L description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 11) chain D residue 47 type sequence I description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 12) chain D residue 61 type sequence R description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 13) chain D residue 63 type sequence V description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 14) chain D residue 65 type sequence E description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 15) chain D residue 66 type sequence M description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 16) chain D residue 69 type sequence M description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 17) chain D residue 70 type sequence L description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 18) chain D residue 81 type sequence I description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 19) chain D residue 145 type sequence Y description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 20) chain D residue 148 type sequence K description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 21) chain D residue 149 type sequence Q description BINDING SITE FOR RESIDUE HEC D 199 source : AC7 22) chain D residue 39 type sequence Y description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 23) chain D residue 42 type sequence K description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 24) chain D residue 43 type sequence Q description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 25) chain D residue 118 type sequence A description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 26) chain D residue 119 type sequence C description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 27) chain D residue 122 type sequence C description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 28) chain D residue 123 type sequence H description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 29) chain D residue 135 type sequence F description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 30) chain D residue 136 type sequence P description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 31) chain D residue 138 type sequence L description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 32) chain D residue 145 type sequence Y description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 33) chain D residue 149 type sequence Q description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 34) chain D residue 158 type sequence R description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 35) chain D residue 160 type sequence N description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 36) chain D residue 166 type sequence I description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 37) chain D residue 167 type sequence M description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 38) chain D residue 170 type sequence V description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 39) chain D residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 40) chain D residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 41) chain D residue 119 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 42) chain D residue 122 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 43) chain D residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 44) chain D residue 66 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 45) chain D residue 123 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 46) chain D residue 167 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links