eF-site ID 1m70-A PDB Code 1m70 Chain A click to enlarge Title Crystal structure of oxidized recombinant cytochrome c4 from Pseudomonas stutzeri Classification ELECTRON TRANSPORT Compound Cytochrome c4 Source null (CYC4_PSEST) Sequence A:  AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYL LKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLED IAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACT GCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTN DGDTMIMRGVAAKLSNKDIEALSSYIQGLH Description Functional site 1) chain A residue 13 type sequence V description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 2) chain A residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 3) chain A residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 4) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 5) chain A residue 29 type sequence F description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 6) chain A residue 30 type sequence P description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 7) chain A residue 32 type sequence L description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 8) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 9) chain A residue 43 type sequence Q description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 10) chain A residue 47 type sequence I description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 11) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 12) chain A residue 63 type sequence V description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 13) chain A residue 65 type sequence E description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 14) chain A residue 66 type sequence M description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 15) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 16) chain A residue 70 type sequence L description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 17) chain A residue 81 type sequence I description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 18) chain A residue 145 type sequence Y description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 19) chain A residue 148 type sequence K description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 20) chain A residue 149 type sequence Q description BINDING SITE FOR RESIDUE HEC A 199 source : AC1 21) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 22) chain A residue 42 type sequence K description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 23) chain A residue 43 type sequence Q description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 24) chain A residue 118 type sequence A description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 25) chain A residue 119 type sequence C description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 26) chain A residue 122 type sequence C description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 27) chain A residue 123 type sequence H description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 28) chain A residue 136 type sequence P description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 29) chain A residue 138 type sequence L description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 30) chain A residue 145 type sequence Y description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 31) chain A residue 149 type sequence Q description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 32) chain A residue 158 type sequence R description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 33) chain A residue 160 type sequence N description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 34) chain A residue 166 type sequence I description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 35) chain A residue 167 type sequence M description BINDING SITE FOR RESIDUE HEC A 200 source : AC2 36) chain A residue 135 type sequence F description BINDING SITE FOR RESIDUE HEC C 199 source : AC5 37) chain A residue 16 type sequence A description BINDING SITE FOR RESIDUE HEC D 200 source : AC8 38) chain A residue 188 type sequence G description BINDING SITE FOR RESIDUE GOL A 201 source : AC9 39) chain A residue 189 type sequence L description BINDING SITE FOR RESIDUE GOL A 201 source : AC9 40) chain A residue 190 type sequence H description BINDING SITE FOR RESIDUE GOL A 201 source : AC9 41) chain A residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 42) chain A residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 43) chain A residue 119 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 44) chain A residue 122 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 45) chain A residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 46) chain A residue 66 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 47) chain A residue 123 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 48) chain A residue 167 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links