eF-site ID 1m6c-B
PDB Code 1m6c
Chain B

click to enlarge
Title V68N MYOGLOBIN WITH CO
Classification OXYGEN STORAGE/TRANSPORT
Compound PROTEIN (MYOGLOBIN)
Source Sus scrofa (Pig) (MYG_PIG)
Sequence B:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTNLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Description (1)  PROTEIN (MYOGLOBIN) MUTANT (V68N)


Functional site

1) chain B
residue 39
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

2) chain B
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

3) chain B
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

4) chain B
residue 45
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

5) chain B
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

6) chain B
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

7) chain B
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

8) chain B
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

9) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

10) chain B
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

11) chain B
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

12) chain B
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

13) chain B
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

14) chain B
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

15) chain B
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

16) chain B
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CMO B 155
source : AC4

17) chain B
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI3

18) chain B
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI4

19) chain B
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

20) chain B
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

21) chain B
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

22) chain B
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence K
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

23) chain B
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

24) chain B
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TN
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

25) chain B
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

26) chain B
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

27) chain B
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

28) chain B
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

29) chain B
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

30) chain B
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

31) chain B
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

32) chain B
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

33) chain B
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154


Display surface

Download
Links