eF-site ID 1m6c-AB
PDB Code 1m6c
Chain A, B

click to enlarge
Title V68N MYOGLOBIN WITH CO
Classification OXYGEN STORAGE/TRANSPORT
Compound PROTEIN (MYOGLOBIN)
Source Sus scrofa (Pig) (MYG_PIG)
Sequence A:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTNLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
B:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTNLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Description (1)  PROTEIN (MYOGLOBIN) MUTANT (V68N)


Functional site

1) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

2) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

3) chain A
residue 45
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

4) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

5) chain A
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

6) chain A
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

7) chain A
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

8) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

9) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

10) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

11) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

12) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

13) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

14) chain A
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

15) chain A
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CMO A 155
source : AC2

16) chain B
residue 39
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

17) chain B
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

18) chain B
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

19) chain B
residue 45
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

20) chain B
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

21) chain B
residue 67
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

22) chain B
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

23) chain B
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

24) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

25) chain B
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

26) chain B
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

27) chain B
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

28) chain B
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

29) chain B
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

30) chain B
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC3

31) chain B
residue 68
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CMO B 155
source : AC4

32) chain A
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

33) chain A
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2

34) chain B
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI3

35) chain B
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI4

36) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

37) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

38) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

39) chain A
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence K
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

40) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

41) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TN
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

42) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

43) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

44) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

45) chain A
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

46) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

47) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

48) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

49) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

50) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_A_154

51) chain B
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

52) chain B
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

53) chain B
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

54) chain B
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence K
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

55) chain B
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

56) chain B
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TN
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

57) chain B
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

58) chain B
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

59) chain B
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

60) chain B
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

61) chain B
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

62) chain B
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

63) chain B
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

64) chain B
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154

65) chain B
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1m6c_B_154


Display surface

Download
Links