eF-site ID 1m40-A PDB Code 1m40 Chain A click to enlarge Title ULTRA HIGH RESOLUTION CRYSTAL STRUCTURE OF TEM-1 Classification HYDROLASE Compound BETA-LACTAMASE TEM Source Escherichia coli (BLAT_ECOLI) Sequence A:  HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER FPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEY SPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP KELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAA MATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSAL PAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG SQATMDERNRQIAEIGASLIKHW Description Functional site 1) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE PO4 A 501 source : AC1 2) chain A residue 215 type sequence K description BINDING SITE FOR RESIDUE PO4 A 501 source : AC1 3) chain A residue 161 type sequence R description BINDING SITE FOR RESIDUE PO4 A 502 source : AC2 4) chain A residue 271 type sequence T description BINDING SITE FOR RESIDUE PO4 A 503 source : AC3 5) chain A residue 273 type sequence D description BINDING SITE FOR RESIDUE PO4 A 503 source : AC3 6) chain A residue 274 type sequence E description BINDING SITE FOR RESIDUE PO4 A 503 source : AC3 7) chain A residue 277 type sequence R description BINDING SITE FOR RESIDUE PO4 A 503 source : AC3 8) chain A residue 57 type sequence L description BINDING SITE FOR RESIDUE K A 1000 source : AC4 9) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE K A 1000 source : AC4 10) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE K A 1000 source : AC4 11) chain A residue 97 type sequence Y description BINDING SITE FOR RESIDUE K A 1001 source : AC5 12) chain A residue 113 type sequence L description BINDING SITE FOR RESIDUE K A 1001 source : AC5 13) chain A residue 240 type sequence E description BINDING SITE FOR RESIDUE K A 1002 source : AC6 14) chain A residue 211 type sequence M description BINDING SITE FOR RESIDUE K A 1003 source : AC7 15) chain A residue 213 type sequence A description BINDING SITE FOR RESIDUE K A 1003 source : AC7 16) chain A residue 214 type sequence D description BINDING SITE FOR RESIDUE K A 1003 source : AC7 17) chain A residue 233 type sequence D description BINDING SITE FOR RESIDUE K A 1003 source : AC7 18) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 19) chain A residue 70 type sequence S description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 20) chain A residue 105 type sequence Y description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 21) chain A residue 130 type sequence S description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 22) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 23) chain A residue 236 type sequence G description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 24) chain A residue 237 type sequence A description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 25) chain A residue 238 type sequence G description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 26) chain A residue 240 type sequence E description BINDING SITE FOR RESIDUE CB4 A 300 source : AC8 27) chain A residue 70 type catalytic sequence S description 2 source MCSA : MCSA1 28) chain A residue 73 type catalytic sequence K description 2 source MCSA : MCSA1 29) chain A residue 130 type catalytic sequence S description 2 source MCSA : MCSA1 30) chain A residue 166 type catalytic sequence E description 2 source MCSA : MCSA1 31) chain A residue 234 type catalytic sequence K description 2 source MCSA : MCSA1 32) chain A residue 237 type catalytic sequence A description 2 source MCSA : MCSA1 33) chain A residue 66-81 type prosite sequence FPMMSTFKVLLCGAVL description BETA_LACTAMASE_A Beta-lactamase class-A active site. FpMMSTfKvllCGAVL source prosite : PS00146 34) chain A residue 70 type ACT_SITE sequence S description Acyl-ester intermediate source Swiss-Prot : SWS_FT_FI1 35) chain A residue 168 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 36) chain A residue 234 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links