eF-site ID 1m38-A PDB Code 1m38 Chain A click to enlarge Title Structure of Inorganic Pyrophosphatase Classification HYDROLASE Compound INORGANIC PYROPHOSPHATASE Source ORGANISM_COMMON: baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence A:  TYTTRQIGAKNTLEYKVYIEKDGKPVSAFHDIPLYADKEN NIFNMVVEIPRWTNAKLEITKEETLNPIIQDTKKGKLRFV RNCFPHHGYIHNYGAFPQTWEDPNVSHPETKAVGDNDPID VLEIGETIAYTGQVKQVKALGIMALLDEGETDWKVIAIDI NDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPE NQFAFSGEAKNKKYALDIIKETHDSWKQLIAGKSSDSKGI DLTNVTLPDTPTYSKAASDAIPPASPKADAPIDKSIDKWF FI Description Functional site 1) chain A residue 115 type sequence D description BINDING SITE FOR RESIDUE CO A 401 source : AC1 2) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE CO A 401 source : AC1 3) chain A residue 152 type sequence D description BINDING SITE FOR RESIDUE CO A 401 source : AC1 4) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE CO A 402 source : AC2 5) chain A residue 56 type sequence K description BINDING SITE FOR RESIDUE CO A 403 source : AC3 6) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE CO A 403 source : AC3 7) chain A residue 147 type sequence D description BINDING SITE FOR RESIDUE CO A 404 source : AC4 8) chain A residue 152 type sequence D description BINDING SITE FOR RESIDUE CO A 404 source : AC4 9) chain A residue 74 type sequence K description BINDING SITE FOR RESIDUE PO4 B 3501 source : AC7 10) chain A residue 56 type sequence K description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 11) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 12) chain A residue 93 type sequence Y description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 13) chain A residue 115 type sequence D description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 14) chain A residue 117 type sequence D description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 15) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 16) chain A residue 152 type sequence D description BINDING SITE FOR RESIDUE PO4 A 3301 source : AC8 17) chain A residue 115-121 type prosite sequence DNDPIDV description PPASE Inorganic pyrophosphatase signature. DNDPIDV source prosite : PS00387 18) chain A residue 89 type ACT_SITE sequence Y description Proton donor => ECO:0000269|PubMed:1322842 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 78 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 115 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 120 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 152 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 64 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 250 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:15665377, ECO:0007744|PubMed:17330950 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 265 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI5 26) chain A residue 238 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI7 27) chain A residue 278 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links