eF-site ID 1m35-A PDB Code 1m35 Chain A click to enlarge Title Aminopeptidase P from Escherichia coli Classification HYDROLASE Compound AMINOPEPTIDASE P Source Escherichia coli (strain K12) (AMPP_ECOLI) Sequence A:  SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSE YPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRV RDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQL LNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPA TMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAME KCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGC ILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNG KFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRI MVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDV HDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRG IGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ Description Functional site 1) chain A residue 260 type sequence D description BINDING SITE FOR RESIDUE MN A 2001 source : AC1 2) chain A residue 271 type sequence D description BINDING SITE FOR RESIDUE MN A 2001 source : AC1 3) chain A residue 273 type sequence T description BINDING SITE FOR RESIDUE MN A 2001 source : AC1 4) chain A residue 406 type sequence E description BINDING SITE FOR RESIDUE MN A 2001 source : AC1 5) chain A residue 271 type sequence D description BINDING SITE FOR RESIDUE MN A 2002 source : AC2 6) chain A residue 354 type sequence H description BINDING SITE FOR RESIDUE MN A 2002 source : AC2 7) chain A residue 383 type sequence E description BINDING SITE FOR RESIDUE MN A 2002 source : AC2 8) chain A residue 406 type sequence E description BINDING SITE FOR RESIDUE MN A 2002 source : AC2 9) chain A residue 39 type catalytic sequence S description 379 source MCSA : MCSA1 10) chain A residue 405 type catalytic sequence I description 379 source MCSA : MCSA1 11) chain A residue 407 type catalytic sequence D description 379 source MCSA : MCSA1 12) chain A residue 244 type catalytic sequence Y description 379 source MCSA : MCSA1 13) chain A residue 261 type catalytic sequence A description 379 source MCSA : MCSA1 14) chain A residue 272 type catalytic sequence I description 379 source MCSA : MCSA1 15) chain A residue 351 type catalytic sequence G description 379 source MCSA : MCSA1 16) chain A residue 355 type catalytic sequence W description 379 source MCSA : MCSA1 17) chain A residue 362 type catalytic sequence D description 379 source MCSA : MCSA1 18) chain A residue 384 type catalytic sequence P description 379 source MCSA : MCSA1 19) chain A residue 388 type catalytic sequence I description 379 source MCSA : MCSA1 20) chain A residue 350-362 type prosite sequence HGLSHWLGLDVHD description PROLINE_PEPTIDASE Aminopeptidase P and proline dipeptidase signature. HGLSHwLGLdVHD source prosite : PS00491 21) chain A residue 261 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 22) chain A residue 272 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 355 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 384 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 407 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links