eF-site ID 1m1y-N PDB Code 1m1y Chain N click to enlarge Title Chemical Crosslink of Nitrogenase MoFe Protein and Fe Protein Classification OXIDOREDUCTASE Compound Nitrogenase molybdenum-iron protein alpha chain Source ORGANISM_SCIENTIFIC: Azotobacter vinelandii; Sequence N:  AMRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDP KADSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGY GGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDLD FVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYA ANNISKGIVKYANSGSVRLGGLICNSRNTDREDELIIALA NKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEY RALARKVVDNKLLVIPNPITMDELEELLMEFGIMEVEDES IVGKTAEEV Description Functional site 1) chain N residue 97 type sequence C description BINDING SITE FOR RESIDUE SF4 N 2290 source : CC1 2) chain N residue 98 type sequence A description BINDING SITE FOR RESIDUE SF4 N 2290 source : CC1 3) chain N residue 132 type sequence C description BINDING SITE FOR RESIDUE SF4 N 2290 source : CC1 4) chain N residue 134 type sequence G description BINDING SITE FOR RESIDUE SF4 N 2290 source : CC1 5) chain N residue 11 type catalytic sequence G description 212 source MCSA : MCSA6 6) chain N residue 16 type catalytic sequence S description 212 source MCSA : MCSA6 7) chain N residue 42 type catalytic sequence A description 212 source MCSA : MCSA6 8) chain N residue 130 type catalytic sequence V description 212 source MCSA : MCSA6 9) chain N residue 10 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 10) chain N residue 98 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 11) chain N residue 133 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 12) chain N residue 101 type MOD_RES sequence G description ADP-ribosylarginine; by dinitrogenase reductase ADP-ribosyltransferase => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links