eF-site ID 1m1g-D
PDB Code 1m1g
Chain D

click to enlarge
Title Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)
Classification TRANSCRIPTION
Compound Transcription antitermination protein nusG
Source Aquifex aeolicus (NUSG_AQUAE)
Sequence D:  EKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVP
AEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIE
NGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIV
LDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKP
VPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFM
NFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Description (1)  Transcription antitermination protein nusG


Functional site

1) chain D
residue 231-240
type prosite
ligand
sequence IFGRMTPVEL
description Transcription termination factor nusG signature. [LIVM]-F-G-[KRW]-x-T-P-[IV]-x-[LIVM]
source prosite : PS01014


Display surface

Download
Links