eF-site ID 1m1a-A PDB Code 1m1a Chain A click to enlarge Title LIGAND BINDING ALTERS THE STRUCTURE AND DYNAMICS OF NUCLEOSOMAL DNA Classification STRUCTURAL PROTEIN/DNA Compound Palindromic 146 Base Pair DNA Fragment Source Xenopus laevis (African clawed frog) (A0A8J0U496_XENLA) Sequence A:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR VTIMPKDIQLARRIRGERA Description Functional site 1) chain A residue 466-474 type prosite sequence PFQRLVREI description HISTONE_H3_2 Histone H3 signature 2. PFqRLVREI source prosite : PS00959 2) chain A residue 456 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI13 3) chain A residue 457 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI14 4) chain A residue 480 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI15 5) chain A residue 515 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI16 6) chain A residue 522 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI17

Display surface Download Links