eF-site ID 1luf-A PDB Code 1luf Chain A click to enlarge Title Crystal Structure of the MuSK Tyrosine Kinase: Insights into Receptor Autoregulation Classification TRANSFERASE Compound muscle-specific tyrosine kinase receptor musk Source Rattus norvegicus (Rat) (MUSK_RAT) Sequence A:  LNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPY EPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVK LLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPPPLSCAEQ LCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIA DFGLSRNIYSADYYKDAIPIRWMPPESIFYNRYTTESDVW AYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPEN CPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCE Description Functional site 1) chain A residue 580 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 2) chain A residue 608 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 724 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 697 type MOD_RES sequence S description Phosphoserine; by CK2 => ECO:0000250|UniProtKB:Q61006 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 754 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:20603078 source Swiss-Prot : SWS_FT_FI5 6) chain A residue 580-608 type prosite sequence IGEGAFGRVFQARAPGLLPYEPFTMVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGEGAFGRVFqArapgllpyepftm.....VAVK source prosite : PS00107 7) chain A residue 720-732 type prosite sequence FVHRDLATRNCLV description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FVHrDLATRNCLV source prosite : PS00109

Display surface Download Links