eF-site ID 1lr4-A
PDB Code 1lr4
Chain A

click to enlarge
Title Room Temperature Crystal Structure of the Apo-form of the catalytic subunit of protein kinase CK2 from Zea mays
Classification TRANSFERASE
Compound Protein kinase CK2
Source Zea mays (Maize) (CSK2A_MAIZE)
Sequence A:  SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVG
RGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQ
NLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYP
TLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDH
ELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDL
QDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIA
KVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMN
ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQ
VRAAENS
Description (1)  Casein kinase II, alpha chain(E.C.2.7.1.37)


Functional site

1) chain A
residue 66
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

2) chain A
residue 68
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

3) chain A
residue 113
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

4) chain A
residue 163
type
ligand
sequence M
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

5) chain A
residue 174
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

6) chain A
residue 175
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BEN A 1001
source : AC1

7) chain A
residue 151
type ACT_SITE
ligand
sequence G
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI1

8) chain A
residue 63
type BINDING
ligand
sequence E
description ATP.
source Swiss-Prot : SWS_FT_FI2

9) chain A
residue 40-48
type NP_BIND
ligand
sequence EVVRKVGRG
description ATP.
source Swiss-Prot : SWS_FT_FI3

10) chain A
residue 149
type catalytic
ligand
sequence S
description Mapped from 2phk to 1lr4 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

11) chain A
residue 151
type catalytic
ligand
sequence G
description Mapped from 2phk to 1lr4 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

12) chain A
residue 152-164
type prosite
ligand
sequence IMHRDVKPHNVMI
description Serine/Threonine protein kinases active-site signature. [LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3)
source prosite : PS00108

13) chain A
residue 45-68
type prosite
ligand
sequence VGRGKYSEVFEGINVNNNEKCIIK
description Protein kinases ATP-binding region signature. [LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]
source prosite : PS00107

14) chain A
residue 53
type binding
ligand BEN: BENZAMIDINE
sequence V
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

15) chain A
residue 66
type binding
ligand BEN: BENZAMIDINE
sequence I
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

16) chain A
residue 68
type binding
ligand BEN: BENZAMIDINE
sequence K
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

17) chain A
residue 81
type binding
ligand BEN: BENZAMIDINE
sequence E
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

18) chain A
residue 95
type binding
ligand BEN: BENZAMIDINE
sequence V
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

19) chain A
residue 113
type binding
ligand BEN: BENZAMIDINE
sequence F
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

20) chain A
residue 163
type binding
ligand BEN: BENZAMIDINE
sequence M
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

21) chain A
residue 174-176
type binding
ligand BEN: BENZAMIDINE
sequence IDW
description BENZAMIDINE binding site
source pdb_hetatom : BEN_1lr4_A_1001

22) chain A
residue 156
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

23) chain A
residue 160
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

24) chain A
residue 156
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

25) chain A
residue 158
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

26) chain A
residue 156
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

27) chain A
residue 158
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

28) chain A
residue 194
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

29) chain A
residue 156
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

30) chain A
residue 161
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

31) chain A
residue 158
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4


Display surface

Download
Links