eF-site ID 1lqx-A PDB Code 1lqx Chain A click to enlarge Title Crystal structure of V45E mutant of cytochrome b5 Classification ELECTRON TRANSPORT Compound cytochrome b5 Source Bos taurus (Bovine) (CYB5_BOVIN) Sequence A:  AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGG EEELREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD DR Description Functional site 1) chain A residue 25 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 2) chain A residue 35 type sequence F description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 3) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 4) chain A residue 40 type sequence P description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 5) chain A residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 6) chain A residue 46 type sequence L description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 7) chain A residue 49 type sequence Q description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 8) chain A residue 57 type sequence N description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 9) chain A residue 58 type sequence F description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 10) chain A residue 63 type sequence H description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 11) chain A residue 64 type sequence S description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 12) chain A residue 67 type sequence A description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 13) chain A residue 71 type sequence S description BINDING SITE FOR RESIDUE HEM A 201 source : AC1 14) chain A residue 40 type BINDING sequence P description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00279, ECO:0000269|PubMed:15299727 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 64 type BINDING sequence S description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00279, ECO:0000269|PubMed:15299727 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 3 type MOD_RES sequence A description N6-acetyllysine => ECO:0000250|UniProtKB:P56395 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 6 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000250|UniProtKB:P56395 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 15 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:P56395 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 35-42 type prosite sequence FLEEHPGG description CYTOCHROME_B5_1 Cytochrome b5 family, heme-binding domain signature. FLEEHPGG source prosite : PS00191

Display surface Download Links