eF-site ID 1lpu-A PDB Code 1lpu Chain A click to enlarge Title Low Temperature Crystal Structure of the Apo-form of the catalytic subunit of protein kinase CK2 from Zea mays Classification TRANSFERASE Compound Protein kinase CK2 Source null (CSK2A_MAIZE) Sequence A:  SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVG RGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQ NLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYP TLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDH ELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDL QDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIA KVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMN ADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQ VRAAENS Description Functional site 1) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 2) chain A residue 95 type sequence V description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 3) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 4) chain A residue 163 type sequence M description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 5) chain A residue 174 type sequence I description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 6) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE BEN A 1001 source : AC1 7) chain A residue 45-68 type prosite sequence VGRGKYSEVFEGINVNNNEKCIIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGRGKYSEVFeGinvnnnek..........CIIK source prosite : PS00107 8) chain A residue 152-164 type prosite sequence IMHRDVKPHNVMI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ImHrDVKphNVMI source prosite : PS00108 9) chain A residue 156 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 10) chain A residue 68 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 11) chain A residue 45 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links