eF-site ID 1loa-H
PDB Code 1loa
Chain H

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence H:  TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWY
FHSELAG
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain H
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

2) chain H
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

3) chain H
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

4) chain H
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

5) chain H
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182


Display surface

Download
Links