eF-site ID 1loa-G
PDB Code 1loa
Chain G

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence G:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain G
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

2) chain G
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

3) chain G
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

4) chain G
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

5) chain G
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

6) chain G
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

7) chain G
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

8) chain G
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

9) chain G
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

10) chain G
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

11) chain G
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

12) chain G
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

13) chain G
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

14) chain G
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

15) chain G
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI10

16) chain G
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI10

17) chain G
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI10

18) chain G
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI11

19) chain G
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI11

20) chain G
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI11

21) chain G
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI11

22) chain G
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI12

23) chain G
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

24) chain G
residue 97-100
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGGY
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

25) chain G
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

26) chain G
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182


Display surface

Download
Links