eF-site ID 1loa-F
PDB Code 1loa
Chain F

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence F:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFHSELA
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain F
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

2) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

3) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

4) chain F
residue 2
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

5) chain F
residue 4
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

6) chain F
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

7) chain F
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182


Display surface

Download
Links