eF-site ID 1loa-E
PDB Code 1loa
Chain E

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence E:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain E
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

2) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

3) chain E
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

4) chain E
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

5) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

6) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

7) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

8) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

9) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

10) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

11) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

12) chain E
residue 153
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

13) chain E
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

14) chain E
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI7

15) chain E
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

16) chain E
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI8

17) chain E
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

18) chain E
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

19) chain E
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI8

20) chain E
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI9

21) chain E
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

22) chain E
residue 98-99
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GG
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

23) chain E
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

24) chain E
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182


Display surface

Download
Links