eF-site ID 1loa-C
PDB Code 1loa
Chain C

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence C:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain C
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

2) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

3) chain C
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

4) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

5) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

6) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

7) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

8) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

9) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

10) chain C
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

11) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

12) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

13) chain C
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

14) chain C
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

15) chain C
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI4

16) chain C
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

17) chain C
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI5

18) chain C
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

19) chain C
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

20) chain C
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI5

21) chain C
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

22) chain C
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

23) chain C
residue 97-100
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGGY
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

24) chain C
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

25) chain C
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182


Display surface

Download
Links