eF-site ID 1loa-ABCDEFGH
PDB Code 1loa
Chain A, B, C, D, E, F, G, H

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence A:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
B:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFHSELA
C:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
D:  TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWY
FHSELAG
E:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
F:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFHSELA
G:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
H:  TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWY
FHSELAG
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain A
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

2) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

3) chain A
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

4) chain A
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

5) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

6) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

7) chain B
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

8) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

9) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

10) chain C
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

11) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

12) chain C
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

13) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

14) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

15) chain D
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

16) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

17) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP C 182
source : AC2

18) chain E
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

19) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

20) chain E
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

21) chain E
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

22) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

23) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

24) chain F
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

25) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

26) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP E 182
source : AC3

27) chain G
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

28) chain G
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

29) chain G
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

30) chain G
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

31) chain G
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

32) chain G
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

33) chain H
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

34) chain H
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

35) chain H
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GYP G 182
source : AC4

36) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

37) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

38) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

39) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

40) chain A
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

41) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

42) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

43) chain A
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

44) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

45) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

46) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

47) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 458
source : AC7

48) chain C
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

49) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

50) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

51) chain C
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 459
source : AC8

52) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

53) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

54) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

55) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

56) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 688
source : AC9

57) chain E
residue 153
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

58) chain F
residue 2
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

59) chain F
residue 4
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE MN F 689
source : BC1

60) chain G
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

61) chain G
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

62) chain G
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

63) chain G
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA G 918
source : BC2

64) chain G
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

65) chain G
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

66) chain G
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

67) chain G
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN G 919
source : BC3

68) chain A
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

69) chain A
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI1

70) chain A
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

71) chain A
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI2

72) chain A
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

73) chain A
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

74) chain A
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI2

75) chain A
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

76) chain C
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

77) chain C
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI4

78) chain C
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

79) chain C
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI5

80) chain C
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

81) chain C
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

82) chain C
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI5

83) chain C
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

84) chain E
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

85) chain E
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI7

86) chain E
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

87) chain E
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI8

88) chain E
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

89) chain E
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

90) chain E
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI8

91) chain E
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI9

92) chain G
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI10

93) chain G
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI10

94) chain G
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI10

95) chain G
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI11

96) chain G
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI11

97) chain G
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI11

98) chain G
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI11

99) chain G
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI12

100) chain B
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

101) chain D
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

102) chain F
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

103) chain H
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

104) chain A
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

105) chain A
residue 97-99
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGG
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

106) chain A
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

107) chain A
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

108) chain B
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

109) chain C
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

110) chain C
residue 97-100
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGGY
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

111) chain C
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

112) chain C
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

113) chain D
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_C_182

114) chain E
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

115) chain E
residue 98-99
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GG
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

116) chain E
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

117) chain E
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

118) chain F
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_E_182

119) chain G
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

120) chain G
residue 97-100
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGGY
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

121) chain G
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

122) chain G
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182

123) chain H
residue 28-31
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence TGAE
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_G_182


Display surface

Download
Links