eF-site ID 1loa-A
PDB Code 1loa
Chain A

click to enlarge
Title THREE-DIMENSIONAL STRUCTURES OF COMPLEXES OF LATHYRUS OCHRUS ISOLECTIN I WITH GLUCOSE AND MANNOSE: FINE SPECIFICITY OF THE MONOSACCHARIDE-BINDING SITE
Classification LECTIN
Compound LEGUME ISOLECTIN I (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC1_LATOC)
Sequence A:  TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEA
NVVIAFNAATNVLTVSLTYP
Description (1)  LECTIN (LEGUME, ISOLECTIN I) COMPLEXED WITH ALPHA-METHYL-GLUCOSE


Functional site

1) chain A
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

2) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

3) chain A
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

4) chain A
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

5) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

6) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GYP A 182
source : AC1

7) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

8) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

9) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

10) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 228
source : AC5

11) chain A
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

12) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

13) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

14) chain A
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 229
source : AC6

15) chain A
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

16) chain A
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI1

17) chain A
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

20) chain A
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

21) chain A
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI2

22) chain A
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

23) chain A
residue 80-81
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence AD
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

24) chain A
residue 97-99
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence GGG
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

25) chain A
residue 123
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence F
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182

26) chain A
residue 125
type binding
ligand GYP: METHYL-ALPHA-D-GLUCOPYRANOSIDE
sequence N
description METHYL-ALPHA-D-GLUCOPYRANOSIDE binding site
source pdb_hetatom : GYP_1loa_A_182


Display surface

Download
Links