eF-site ID 1ln6-A
PDB Code 1ln6
Chain A

click to enlarge
Title STRUCTURE OF BOVINE RHODOPSIN (Metarhodopsin II)
Classification MEMBRANE PROTEIN
Compound RHODOPSIN
Source Bos taurus (Bovine) (OPSD_BOVIN)
Sequence A:  LAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNL
AVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATL
GGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAF
TWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETN
NESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQE
SATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQ
GSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVT
TLCCGKNPLGDDEASTTVSKTETSQVAPA
Description (1)  RHODOPSIN


Functional site

1) chain A
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

2) chain A
residue 86
type
ligand
sequence M
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

3) chain A
residue 116
type
ligand
sequence F
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

4) chain A
residue 117
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

5) chain A
residue 118
type
ligand
sequence T
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

6) chain A
residue 120
type
ligand
sequence G
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

7) chain A
residue 121
type
ligand
sequence G
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

8) chain A
residue 169
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

9) chain A
residue 207
type
ligand
sequence M
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

10) chain A
residue 265
type
ligand
sequence W
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

11) chain A
residue 295
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

12) chain A
residue 296
type
ligand
sequence K
description BINDING SITE FOR RESIDUE RET A 400
source : AC1

13) chain A
residue 201
type METAL
ligand
sequence E
description Zinc
source Swiss-Prot : SWS_FT_FI1

14) chain A
residue 279
type METAL
ligand
sequence Q
description Zinc
source Swiss-Prot : SWS_FT_FI1

15) chain A
residue 265
type BINDING
ligand
sequence W
description Retinal chromophore.
source Swiss-Prot : SWS_FT_FI2

16) chain A
residue 296
type BINDING
ligand
sequence K
description Retinal chromophore (covalent).
source Swiss-Prot : SWS_FT_FI3

17) chain A
residue 203-224
type TRANSMEM
ligand
sequence FVIYMFVVHFIIPLIVIFFCYG
description Helical; Name=5.
source Swiss-Prot : SWS_FT_FI4

18) chain A
residue 250-274
type TRANSMEM
ligand
sequence VTRMVIIMVIAFLICWLPYAGVAFY
description Helical; Name=6.
source Swiss-Prot : SWS_FT_FI5

19) chain A
residue 287-308
type TRANSMEM
ligand
sequence FMTIPAFFAKTSAVYNPVIYIM
description Helical; Name=7.
source Swiss-Prot : SWS_FT_FI7

20) chain A
residue 74-96
type TRANSMEM
ligand
sequence YILLNLAVADLFMVFGGFTTTLY
description Helical; Name=2.
source Swiss-Prot : SWS_FT_FI8

21) chain A
residue 111-133
type TRANSMEM
ligand
sequence NLEGFFATLGGEIALWSLVVLAI
description Helical; Name=3.
source Swiss-Prot : SWS_FT_FI9

22) chain A
residue 153-173
type TRANSMEM
ligand
sequence AIMGVAFTWVMALACAAPPLV
description Helical; Name=4.
source Swiss-Prot : SWS_FT_FI10

23) chain A
residue 123-139
type prosite
ligand
sequence IALWSLVVLAIERYVVV
description G-protein coupled receptors family 1 signature. [GSTALIVMFYWC]-[GSTANCPDE]-{EDPKRH}-x-{PQ}-[LIVMNQGA]-{RK}-{RK}-[LIVMFT]
source prosite : PS00237

24) chain A
residue 290-306
type prosite
ligand
sequence IPAFFAKTSAVYNPVIY
description Visual pigments (opsins) retinal binding site. [LIVMFWAC]-[PSGAC]-x-{G}-x-[SAC]-K-[STALIMR]-[GSACPNV]-[STACP]-x(2)
source prosite : PS00238

25) chain A
residue 82-83
type binding
ligand RET: RETINAL
sequence AD
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

26) chain A
residue 86
type binding
ligand RET: RETINAL
sequence M
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

27) chain A
residue 116-122
type binding
ligand RET: RETINAL
sequence FATLGGE
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

28) chain A
residue 166
type binding
ligand RET: RETINAL
sequence A
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

29) chain A
residue 169-170
type binding
ligand RET: RETINAL
sequence AP
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

30) chain A
residue 173
type binding
ligand RET: RETINAL
sequence V
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

31) chain A
residue 203
type binding
ligand RET: RETINAL
sequence F
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

32) chain A
residue 205-208
type binding
ligand RET: RETINAL
sequence IYMF
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

33) chain A
residue 264-266
type binding
ligand RET: RETINAL
sequence CWL
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

34) chain A
residue 268-269
type binding
ligand RET: RETINAL
sequence YA
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

35) chain A
residue 272
type binding
ligand RET: RETINAL
sequence A
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

36) chain A
residue 295-296
type binding
ligand RET: RETINAL
sequence AK
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400

37) chain A
residue 298-299
type binding
ligand RET: RETINAL
sequence SA
description RETINAL binding site
source pdb_hetatom : RET_1ln6_A_400


Display surface

Download
Links