eF-site ID 1lhi-A
PDB Code 1lhi
Chain A

click to enlarge
Title ROLE OF PROLINE RESIDUES IN HUMAN LYSOZYME STABILITY: A SCANNING CALORIMETRIC STUDY COMBINED WITH X-RAY STRUCTURE ANALYSIS OF PROLINE MUTANTS
Classification HYDROLASE(O-GLYCOSYL)
Compound HUMAN LYSOZYME
Source Homo sapiens (Human) (LYSC_HUMAN)
Sequence A:  KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNT
RATNYNAGDRSTDYGIFQINSRYWCNDGKTGGAVNACHLS
CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD
VRQYVQGCGV
Description (1)  LYSOZYME (E.C.3.2.1.17) MUTANT WITH PRO 71 REPLACED BY GLY (P71G)


Functional site

1) chain A
residue 35
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 53
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 77-95
type prosite
ligand
sequence CHLSCSALLQDNIADAVAC
description Alpha-lactalbumin / lysozyme C signature. C-x(3)-C-x(2)-[LMF]-x(3)-[DEN]-[LI]-x(5)-C
source prosite : PS00128

4) chain A
residue 35
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 132l
source CSA : CSA1

5) chain A
residue 53
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 132l
source CSA : CSA1


Display surface

Download
Links