eF-site ID 1lgc-F
PDB Code 1lgc
Chain F

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence F:  TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWY
FNSELSV
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain F
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

2) chain F
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

3) chain F
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

4) chain F
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 3
source : B3

5) chain F
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 3
source : B3

6) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

7) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

8) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BMA J 502
source : CC3

9) chain F
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

10) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

11) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG J 508
source : CC7

12) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG J 508
source : CC7

13) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

14) chain F
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

15) chain F
residue 28-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

16) chain F
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

17) chain F
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

18) chain F
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_509

19) chain F
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_J_502

20) chain F
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_508


Display surface

Download
Links