eF-site ID 1lgc-E
PDB Code 1lgc
Chain E

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence E:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain E
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

2) chain E
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

3) chain E
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

4) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

5) chain E
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

6) chain E
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

7) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

8) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

9) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA J 502
source : CC3

10) chain E
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

11) chain E
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

12) chain E
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG J 509
source : CC8

13) chain E
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

14) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

15) chain E
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

16) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

17) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

18) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

19) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

20) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

21) chain E
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

22) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

23) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

24) chain E
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

25) chain E
residue 146
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

26) chain E
residue 148
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

27) chain E
residue 149
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

28) chain E
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

29) chain E
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI7

30) chain E
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

31) chain E
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI8

32) chain E
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

33) chain E
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

34) chain E
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI8

35) chain E
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI9

36) chain E
residue 130
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence P
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

37) chain E
residue 145-149
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence KSINT
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

38) chain E
residue 39
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_J_511

39) chain E
residue 96
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_J_511

40) chain E
residue 39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

41) chain E
residue 96-98
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

42) chain E
residue 100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

43) chain E
residue 39
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

44) chain E
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

45) chain E
residue 97-99
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGG
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

46) chain E
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

47) chain E
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

48) chain E
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

49) chain E
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

50) chain E
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_509

51) chain E
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_J_502

52) chain E
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_508


Display surface

Download
Links