eF-site ID 1lgc-D
PDB Code 1lgc
Chain D

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence D:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFNSELSV
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain D
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

2) chain D
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

3) chain D
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

4) chain D
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 2
source : B2

5) chain D
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 2
source : B2

6) chain D
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

7) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

8) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

9) chain D
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

10) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

11) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG I 508
source : BC8

12) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG I 508
source : BC8

13) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

14) chain D
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

15) chain D
residue 28-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

16) chain D
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

17) chain D
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

18) chain D
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

19) chain D
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

20) chain D
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_I_502


Display surface

Download
Links