eF-site ID 1lgc-C
PDB Code 1lgc
Chain C

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence C:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain C
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

2) chain C
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

3) chain C
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

4) chain C
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

5) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

6) chain C
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

7) chain C
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

8) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

9) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

10) chain C
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

11) chain C
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

12) chain C
residue 97
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

13) chain C
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG I 509
source : BC9

14) chain C
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

15) chain C
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

16) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

17) chain C
residue 131
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

18) chain C
residue 132
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

19) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

20) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

21) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

22) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

23) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

24) chain C
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

25) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

26) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

27) chain C
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

28) chain C
residue 146
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

29) chain C
residue 23
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

30) chain C
residue 25
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

31) chain C
residue 35
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

32) chain C
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

33) chain C
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI4

34) chain C
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

35) chain C
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI5

36) chain C
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

37) chain C
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

38) chain C
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI5

39) chain C
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

40) chain C
residue 23
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence D
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

41) chain C
residue 25
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence Y
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

42) chain C
residue 35
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence K
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

43) chain C
residue 39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

44) chain C
residue 96-100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGGGY
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

45) chain C
residue 75
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

46) chain C
residue 77-78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence YN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

47) chain C
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

48) chain C
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

49) chain C
residue 135
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

50) chain C
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

51) chain C
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

52) chain C
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

53) chain C
residue 97-100
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGGY
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

54) chain C
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

55) chain C
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

56) chain C
residue 96
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_I_511

57) chain C
residue 100
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_I_511

58) chain C
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_I_502


Display surface

Download
Links