eF-site ID 1lgc-B
PDB Code 1lgc
Chain B

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence B:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFNSELSVTSS
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain B
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

2) chain B
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

3) chain B
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

4) chain B
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 1
source : B1

5) chain B
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 1
source : B1

6) chain B
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

7) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

8) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

9) chain B
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

10) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

11) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG H 520
source : AC7

12) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG H 520
source : AC7

13) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC H 522
source : AC9

14) chain B
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

15) chain B
residue 29-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

16) chain B
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

17) chain B
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

18) chain B
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

19) chain B
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_H_515

20) chain B
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_520


Display surface

Download
Links