eF-site ID 1lgc-ABCDEFHIJ
PDB Code 1lgc
Chain A, B, C, D, E, F, H, I, J

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence A:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
B:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFNSELSVTSS
C:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
D:  ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSW
YFNSELSV
E:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
F:  TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWY
FNSELSV
H:  N
I:  N
J:  NQ
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain A
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

2) chain A
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

3) chain A
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

4) chain B
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

5) chain B
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

6) chain B
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

7) chain B
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 1
source : B1

8) chain B
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 1
source : B1

9) chain C
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

10) chain C
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

11) chain C
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

12) chain D
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

13) chain D
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

14) chain D
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 2
source : A2

15) chain D
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 2
source : B2

16) chain D
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 2
source : B2

17) chain E
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

18) chain E
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

19) chain E
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

20) chain F
residue 29
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

21) chain F
residue 30
type
ligand
sequence A
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

22) chain F
residue 31
type
ligand
sequence E
description MANNOSE (MAN 4) BINDING SITE 3
source : A3

23) chain F
residue 32
type
ligand
sequence F
description FUCOSE (FUC 1) BINDING CAVITY 3
source : B3

24) chain F
residue 31
type
ligand
sequence E
description FUCOSE (FUC 1) BINDING CAVITY 3
source : B3

25) chain A
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

26) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

27) chain A
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

28) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

29) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

30) chain B
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

31) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

32) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

33) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA H 515
source : AC2

34) chain A
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

35) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

36) chain B
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

37) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

38) chain A
residue 38
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GAL H 517
source : AC4

39) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FUC H 518
source : AC5

40) chain B
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG H 520
source : AC7

41) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG H 520
source : AC7

42) chain A
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG H 521
source : AC8

43) chain H
residue 512
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG H 521
source : AC8

44) chain A
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC H 522
source : AC9

45) chain B
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC H 522
source : AC9

46) chain C
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

47) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

48) chain C
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

49) chain C
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

50) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

51) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

52) chain D
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

53) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

54) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN I 501
source : BC2

55) chain C
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

56) chain C
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

57) chain C
residue 97
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

58) chain D
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

59) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG I 505
source : BC3

60) chain D
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG I 508
source : BC8

61) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG I 508
source : BC8

62) chain C
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG I 509
source : BC9

63) chain I
residue 512
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG I 509
source : BC9

64) chain C
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

65) chain C
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

66) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

67) chain D
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC I 510
source : CC1

68) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

69) chain E
residue 98
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

70) chain E
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

71) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

72) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

73) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

74) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAN J 501
source : CC2

75) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA J 502
source : CC3

76) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BMA J 502
source : CC3

77) chain E
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

78) chain E
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

79) chain F
residue 29
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

80) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG J 505
source : CC4

81) chain F
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAG J 508
source : CC7

82) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAG J 508
source : CC7

83) chain E
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG J 509
source : CC8

84) chain J
residue 512
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG J 509
source : CC8

85) chain E
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

86) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

87) chain F
residue 31
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FUC J 510
source : CC9

88) chain C
residue 131
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

89) chain C
residue 132
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

90) chain E
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA J 511
source : DC1

91) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

92) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

93) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

94) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

95) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

96) chain A
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

97) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

98) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

99) chain A
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

100) chain C
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

101) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

102) chain C
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

103) chain C
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

104) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 301
source : DC4

105) chain C
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

106) chain C
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

107) chain C
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

108) chain C
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

109) chain C
residue 146
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MN C 302
source : DC5

110) chain E
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

111) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

112) chain E
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

113) chain E
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

114) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA E 301
source : DC6

115) chain E
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

116) chain E
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

117) chain E
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

118) chain E
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN E 302
source : DC7

119) chain C
residue 23
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

120) chain C
residue 25
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

121) chain C
residue 35
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

122) chain E
residue 146
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

123) chain E
residue 148
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

124) chain E
residue 149
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MPD E 303
source : DC8

125) chain A
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

126) chain A
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI1

127) chain A
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

128) chain A
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI2

129) chain A
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

130) chain A
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

131) chain A
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI2

132) chain A
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

133) chain C
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

134) chain C
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI4

135) chain C
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI4

136) chain C
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI5

137) chain C
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

138) chain C
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI5

139) chain C
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI5

140) chain C
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

141) chain E
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

142) chain E
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI7

143) chain E
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

144) chain E
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI8

145) chain E
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

146) chain E
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

147) chain E
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI8

148) chain E
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI9

149) chain B
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

150) chain D
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

151) chain F
residue 16-25
type prosite
ligand
sequence VPEWVRIGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

152) chain A
residue 38-39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence RN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

153) chain A
residue 96-100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGGGY
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

154) chain B
residue 29-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

155) chain A
residue 38-39
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1lgc_H_517

156) chain A
residue 39
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

157) chain A
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

158) chain A
residue 97-100
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGGY
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

159) chain A
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

160) chain A
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

161) chain B
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

162) chain A
residue 75
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

163) chain A
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

164) chain H
residue 512
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

165) chain B
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

166) chain A
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

167) chain A
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

168) chain A
residue 135
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

169) chain B
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

170) chain A
residue 96-97
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence TG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_518

171) chain A
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_H_515

172) chain B
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_H_515

173) chain A
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_520

174) chain B
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_520

175) chain C
residue 23
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence D
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

176) chain C
residue 25
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence Y
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

177) chain C
residue 35
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence K
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

178) chain E
residue 130
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence P
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

179) chain E
residue 145-149
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence KSINT
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1lgc_E_303

180) chain C
residue 39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

181) chain C
residue 96-100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGGGY
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

182) chain D
residue 28-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_505

183) chain C
residue 75
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

184) chain C
residue 77-78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence YN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

185) chain I
residue 512
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

186) chain D
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_509

187) chain C
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

188) chain C
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

189) chain C
residue 135
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

190) chain D
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_I_510

191) chain C
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

192) chain C
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

193) chain D
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_I_508

194) chain C
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

195) chain C
residue 97-100
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGGY
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

196) chain C
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

197) chain C
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

198) chain D
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_I_501

199) chain C
residue 96
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_I_511

200) chain C
residue 100
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_I_511

201) chain C
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_I_502

202) chain D
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_I_502

203) chain E
residue 39
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_J_511

204) chain E
residue 96
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1lgc_J_511

205) chain E
residue 39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

206) chain E
residue 96-98
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

207) chain E
residue 100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

208) chain F
residue 28-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_505

209) chain E
residue 39
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

210) chain E
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

211) chain E
residue 97-99
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGG
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

212) chain E
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

213) chain E
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

214) chain F
residue 28-31
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence TGAE
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_J_501

215) chain E
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

216) chain E
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

217) chain F
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_J_510

218) chain E
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_509

219) chain J
residue 512
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_509

220) chain F
residue 31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_509

221) chain E
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_J_502

222) chain F
residue 30
type binding
ligand BMA: BETA-D-MANNOSE
sequence A
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_J_502

223) chain E
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_508

224) chain F
residue 30-31
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_J_508


Display surface

Download
Links