eF-site ID 1lgc-A
PDB Code 1lgc
Chain A

click to enlarge
Title INTERACTION OF A LEGUME LECTIN WITH THE N2 FRAGMENT OF HUMAN LACTOTRANSFERRIN OR WITH THE ISOLATED BIANTENNARY GLYCOPEPTIDE: ROLE OF THE FUCOSE MOIETY
Classification LECTIN
Compound LEGUME ISOLECTIN II (ALPHA CHAIN)
Source Lathyrus ochrus (Yellow-flowered pea) (LEC2_LATOC)
Sequence A:  TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNT
VGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVA
DGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEA
NVVIAFNGATNVLTVSLTYPN
Description (1)  LEGUME ISOLECTIN II (LOL II) COMPLEXED WITH A HUMAN LACTOTRANSFERRIN GLYCOPEPTIDE


Functional site

1) chain A
residue 99
type
ligand
sequence G
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

2) chain A
residue 81
type
ligand
sequence D
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

3) chain A
residue 125
type
ligand
sequence N
description MANNOSE (MAN 4) BINDING SITE 1
source : A1

4) chain A
residue 80
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

5) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

6) chain A
residue 99
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

7) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

8) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAN H 514
source : AC1

9) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA H 515
source : AC2

10) chain A
residue 39
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

11) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG H 516
source : AC3

12) chain A
residue 38
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GAL H 517
source : AC4

13) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FUC H 518
source : AC5

14) chain A
residue 78
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG H 521
source : AC8

15) chain A
residue 77
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC H 522
source : AC9

16) chain A
residue 81
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

17) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

18) chain A
residue 123
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

19) chain A
residue 125
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

20) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : DC2

21) chain A
residue 119
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

22) chain A
residue 121
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

23) chain A
residue 129
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

24) chain A
residue 136
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 302
source : DC3

25) chain A
residue 121
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

26) chain A
residue 125
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI1

27) chain A
residue 129
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI1

28) chain A
residue 119
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI2

29) chain A
residue 121
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

30) chain A
residue 129
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI2

31) chain A
residue 136
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI2

32) chain A
residue 123
type METAL
ligand
sequence F
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

33) chain A
residue 38-39
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence RN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

34) chain A
residue 96-100
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TGGGY
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_516

35) chain A
residue 38-39
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1lgc_H_517

36) chain A
residue 39
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

37) chain A
residue 80-81
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence AD
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

38) chain A
residue 97-100
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence GGGY
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

39) chain A
residue 123
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

40) chain A
residue 125
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence N
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1lgc_H_514

41) chain A
residue 75
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

42) chain A
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_521

43) chain A
residue 77-79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YNV
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

44) chain A
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

45) chain A
residue 135
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_522

46) chain A
residue 96-97
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence TG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1lgc_H_518

47) chain A
residue 123
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1lgc_H_515

48) chain A
residue 123
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1lgc_H_520


Display surface

Download
Links