eF-site ID 1ldm-A PDB Code 1ldm Chain A click to enlarge Title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase Classification OXIDOREDUCTASE Compound M4 LACTATE DEHYDROGENASE Source Squalus acanthias (Spiny dogfish) (LDHA_SQUAC) Sequence A:  ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISIL MKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSG KDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFI IPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIG SGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSV WSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIK LKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGI KDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTL WDIQKDLKF Description Functional site 1) chain A residue 28 type sequence V description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 2) chain A residue 29 type sequence G description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 3) chain A residue 52 type sequence D description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 4) chain A residue 53 type sequence V description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 5) chain A residue 53 type sequence V description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 6) chain A residue 54 type sequence M description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 7) chain A residue 54 type sequence M description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 8) chain A residue 55 type sequence E description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 9) chain A residue 56 type sequence D description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 10) chain A residue 57 type sequence K description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 11) chain A residue 58 type sequence L description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 12) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 13) chain A residue 60 type sequence G description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 14) chain A residue 61 type sequence E description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 15) chain A residue 79 type sequence S description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 16) chain A residue 81 type sequence K description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 17) chain A residue 82 type sequence D description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 18) chain A residue 83 type sequence Y description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 19) chain A residue 83 type sequence Y description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 20) chain A residue 95 type sequence T description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 21) chain A residue 96 type sequence A description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 22) chain A residue 98 type sequence A description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 23) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 24) chain A residue 136 type sequence V description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 25) chain A residue 137 type sequence S description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 26) chain A residue 138 type sequence N description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 27) chain A residue 161 type sequence S description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 28) chain A residue 193 type sequence H description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 29) chain A residue 241 type sequence L description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 30) chain A residue 242 type sequence K description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 31) chain A residue 244 type sequence Y description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 32) chain A residue 246 type sequence S description BINDING SITE FOR RESIDUE NAD A 330 source : AC1 33) chain A residue 106 type sequence R description BINDING SITE FOR RESIDUE OXM A 331 source : AC2 34) chain A residue 193 type sequence H description BINDING SITE FOR RESIDUE OXM A 331 source : AC2 35) chain A residue 235 type sequence A description BINDING SITE FOR RESIDUE OXM A 331 source : AC2 36) chain A residue 111 type sequence Q description BINDING SITE FOR RESIDUE OXM A 332 source : AC3 37) chain A residue 171 type sequence R description BINDING SITE FOR RESIDUE OXM A 332 source : AC3 38) chain A residue 186 type sequence H description BINDING SITE FOR RESIDUE OXM A 332 source : AC3 39) chain A residue 291 type sequence V description BINDING SITE FOR RESIDUE OXM A 332 source : AC3 40) chain A residue 107 type catalytic sequence L description 584 source MCSA : MCSA1 41) chain A residue 167 type catalytic sequence S description 584 source MCSA : MCSA1 42) chain A residue 170 type catalytic sequence F description 584 source MCSA : MCSA1 43) chain A residue 194 type catalytic sequence G description 584 source MCSA : MCSA1 44) chain A residue 30 type BINDING sequence A description BINDING => ECO:0000269|PubMed:3430615 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 100 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:3430615 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 2 type MOD_RES sequence T description N-acetylalanine => ECO:0000269|PubMed:838743 source Swiss-Prot : SWS_FT_FI5 47) chain A residue 190-196 type prosite sequence IGEHGDS description L_LDH L-lactate dehydrogenase active site. IGEHGDS source prosite : PS00064 48) chain A residue 194 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI1 49) chain A residue 107 type BINDING sequence L description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 50) chain A residue 139 type BINDING sequence P description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 51) chain A residue 249 type BINDING sequence I description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 52) chain A residue 170 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI4

Display surface Download Links