eF-site ID 1ldc-B
PDB Code 1ldc
Chain B

click to enlarge
Title X-RAY STRUCTURE OF TWO COMPLEXES OF THE Y143F FLAVOCYTOCHROME B2 MUTANT CRYSTALLIZED IN THE PRESENCE OF LACTATE OR PHENYL-LACTATE
Classification OXIDOREDUCTASE
Compound L-LACTATE DEHYDROGENASE
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (CYB2_YEAST)
Sequence B:  TKEDIARKEQLKSLLPPLDNIINLYDFEYLASQTLTKQAW
AFYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDIST
DMLGSHVDVPFYVSATALCKLGNPLEGEKDVARGCGQGVT
KVPQMISTLASCSPEEIIEAAPSDKQIQWYQLYVNSDRKI
TDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFIDPS
LTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVV
LSNHGGRQLDFSRAPIEVLAETMPILEQRNLKDKLEVFVD
GGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEK
AIEILRDEIEMSMRLLGVTSIAELKPDLLDLSTLKARTVG
VPNDVLYNEVYEGPTLTEFEDA
Description (1)  L-LACTATE DEHYDROGENASE: CYTOCHROME C OXIDOREDUCTASE (FLAVOCYTOCHROME B2) (E.C.1.1.2.3) MUTANT WITH TYR 143 REPLACED BY PHE (Y143F) COMPLEXED WITH PYRUVATE


Functional site

1) chain B
residue 143
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

2) chain B
residue 144
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

3) chain B
residue 195
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

4) chain B
residue 196
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

5) chain B
residue 197
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

6) chain B
residue 198
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

7) chain B
residue 228
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

8) chain B
residue 252
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

9) chain B
residue 254
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

10) chain B
residue 280
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

11) chain B
residue 349
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

12) chain B
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

13) chain B
residue 374
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

14) chain B
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

15) chain B
residue 409
type
ligand
sequence D
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

16) chain B
residue 410
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

17) chain B
residue 411
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

18) chain B
residue 413
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

19) chain B
residue 432
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

20) chain B
residue 433
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

21) chain B
residue 436
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

22) chain B
residue 143
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

23) chain B
residue 198
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

24) chain B
residue 254
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

25) chain B
residue 289
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

26) chain B
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

27) chain B
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

28) chain B
residue 373
type ACT_SITE
ligand
sequence H
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI4

29) chain B
residue 376
type BINDING
ligand
sequence R
description Substrate.
source Swiss-Prot : SWS_FT_FI6

30) chain B
residue 371-377
type prosite
ligand
sequence SNHGGRQ
description FMN-dependent alpha-hydroxy acid dehydrogenases active site. S-N-H-G-[AG]-R-Q
source prosite : PS00557

31) chain B
residue 143-144
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence FY
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

32) chain B
residue 154
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence H
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

33) chain B
residue 157
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence N
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

34) chain B
residue 195-198
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence SATA
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

35) chain B
residue 226
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence M
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

36) chain B
residue 228-230
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence STL
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

37) chain B
residue 252
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence Q
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

38) chain B
residue 254
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence Y
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

39) chain B
residue 280
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence T
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

40) chain B
residue 349
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence K
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

41) chain B
residue 371-374
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence SNHG
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

42) chain B
residue 376
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence R
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

43) chain B
residue 409-413
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence DGGVR
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

44) chain B
residue 430-434
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence GLGRP
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

45) chain B
residue 436
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence L
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_1ldc_B_570

46) chain B
residue 143
type binding
ligand PYR: PYRUVIC ACID
sequence F
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

47) chain B
residue 198
type binding
ligand PYR: PYRUVIC ACID
sequence A
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

48) chain B
residue 230
type binding
ligand PYR: PYRUVIC ACID
sequence L
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

49) chain B
residue 254
type binding
ligand PYR: PYRUVIC ACID
sequence Y
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

50) chain B
residue 286
type binding
ligand PYR: PYRUVIC ACID
sequence L
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

51) chain B
residue 289
type binding
ligand PYR: PYRUVIC ACID
sequence R
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

52) chain B
residue 373
type binding
ligand PYR: PYRUVIC ACID
sequence H
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

53) chain B
residue 376-377
type binding
ligand PYR: PYRUVIC ACID
sequence RQ
description PYRUVIC ACID binding site
source pdb_hetatom : PYR_1ldc_B_580

54) chain B
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

55) chain B
residue 143
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

56) chain B
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

57) chain B
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

58) chain B
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

59) chain B
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

60) chain B
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

61) chain B
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

62) chain B
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4


Display surface

Download
Links