eF-site ID 1ldc-AB
PDB Code 1ldc
Chain A, B

click to enlarge
Title X-RAY STRUCTURE OF TWO COMPLEXES OF THE Y143F FLAVOCYTOCHROME B2 MUTANT CRYSTALLIZED IN THE PRESENCE OF LACTATE OR PHENYL-LACTATE
Classification OXIDOREDUCTASE
Compound L-LACTATE DEHYDROGENASE
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (CYB2_YEAST)
Sequence A:  KISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDV
IKFNAGKDVTAIFEPLHAPNVIDKYIAPEKKLGPLQGSMP
PELVCPPYAPGETKEDIARKEQLKSLLPPLDNIINLYDFE
YLASQTLTKQAWAFYSSGANDEVTHRENHNAYHRIFFKPK
ILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEGE
KDVARGCGQGVTKVPQMISTLASCSPEEIIEAAPSDKQIQ
WYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQR
EKDMKLKALSKFIDPSLTWKDIEELKKKTKLPIVIKGVQR
TEDVIKAAEIGVSGVVLSNHGGRQLDFSRAPIEVLAETMP
ILEQRNLKDKLEVFVDGGVRRGTDVLKALCLGAKGVGLGR
PFLYANSCYGRNGVEKAIEILRDEIEMSMRLLGVTSIAEL
KPDLLDLSTLKARTVGVPNDVLYNEVYEGPTLTEFEDA
B:  TKEDIARKEQLKSLLPPLDNIINLYDFEYLASQTLTKQAW
AFYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDIST
DMLGSHVDVPFYVSATALCKLGNPLEGEKDVARGCGQGVT
KVPQMISTLASCSPEEIIEAAPSDKQIQWYQLYVNSDRKI
TDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLKFIDPS
LTWKDIEELKKKTKLPIVIKGVQRTEDVIKAAEIGVSGVV
LSNHGGRQLDFSRAPIEVLAETMPILEQRNLKDKLEVFVD
GGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEK
AIEILRDEIEMSMRLLGVTSIAELKPDLLDLSTLKARTVG
VPNDVLYNEVYEGPTLTEFEDA
Description (1)  L-LACTATE DEHYDROGENASE: CYTOCHROME C OXIDOREDUCTASE (FLAVOCYTOCHROME B2) (E.C.1.1.2.3) MUTANT WITH TYR 143 REPLACED BY PHE (Y143F) COMPLEXED WITH PYRUVATE


Functional site

1) chain A
residue 144
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

2) chain A
residue 195
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

3) chain A
residue 196
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

4) chain A
residue 197
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

5) chain A
residue 198
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

6) chain A
residue 228
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

7) chain A
residue 252
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

8) chain A
residue 280
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

9) chain A
residue 349
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

10) chain A
residue 371
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

11) chain A
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

12) chain A
residue 374
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

13) chain A
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

14) chain A
residue 409
type
ligand
sequence D
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

15) chain A
residue 410
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

16) chain A
residue 411
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

17) chain A
residue 413
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

18) chain A
residue 432
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

19) chain A
residue 433
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN A 570
source : AC1

20) chain A
residue 36
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

21) chain A
residue 39
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

22) chain A
residue 43
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

23) chain A
residue 44
type
ligand
sequence P
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

24) chain A
residue 49
type
ligand
sequence V
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

25) chain A
residue 62
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

26) chain A
residue 66
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

27) chain A
residue 70
type
ligand
sequence V
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

28) chain A
residue 71
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

29) chain A
residue 75
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

30) chain A
residue 97
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

31) chain A
residue 139
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

32) chain A
residue 199
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

33) chain A
residue 230
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

34) chain A
residue 296
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 560
source : AC2

35) chain A
residue 143
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PYR A 580
source : AC3

36) chain A
residue 254
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PYR A 580
source : AC3

37) chain A
residue 289
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR A 580
source : AC3

38) chain A
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PYR A 580
source : AC3

39) chain A
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR A 580
source : AC3

40) chain B
residue 143
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

41) chain B
residue 144
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

42) chain B
residue 195
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

43) chain B
residue 196
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

44) chain B
residue 197
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

45) chain B
residue 198
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

46) chain B
residue 228
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

47) chain B
residue 252
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

48) chain B
residue 254
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

49) chain B
residue 280
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

50) chain B
residue 349
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

51) chain B
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

52) chain B
residue 374
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

53) chain B
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

54) chain B
residue 409
type
ligand
sequence D
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

55) chain B
residue 410
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

56) chain B
residue 411
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

57) chain B
residue 413
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

58) chain B
residue 432
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

59) chain B
residue 433
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

60) chain B
residue 436
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FMN B 570
source : AC4

61) chain B
residue 143
type
ligand
sequence F
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

62) chain B
residue 198
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

63) chain B
residue 254
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

64) chain B
residue 289
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

65) chain B
residue 373
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

66) chain B
residue 376
type
ligand
sequence R
description BINDING SITE FOR RESIDUE PYR B 580
source : AC5

67) chain A
residue 373
type ACT_SITE
ligand
sequence H
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI1

68) chain A
residue 43
type METAL
ligand
sequence H
description Iron (heme axial ligand) (By similarity)
source Swiss-Prot : SWS_FT_FI2

69) chain A
residue 66
type METAL
ligand
sequence H
description Iron (heme axial ligand) (By similarity)
source Swiss-Prot : SWS_FT_FI2

70) chain A
residue 376
type BINDING
ligand
sequence R
description Substrate.
source Swiss-Prot : SWS_FT_FI3

71) chain B
residue 373
type ACT_SITE
ligand
sequence H
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI4

72) chain B
residue 376
type BINDING
ligand
sequence R
description Substrate.
source Swiss-Prot : SWS_FT_FI6

73) chain A
residue 371-377
type prosite
ligand
sequence SNHGGRQ
description FMN-dependent alpha-hydroxy acid dehydrogenases active site.S-N-H-G-[AG]-R-Q.
source prosite : PS00557

74) chain B
residue 371-377
type prosite
ligand
sequence SNHGGRQ
description FMN-dependent alpha-hydroxy acid dehydrogenases active site.S-N-H-G-[AG]-R-Q.
source prosite : PS00557

75) chain A
residue 39-46
type prosite
ligand
sequence FLPNHPGG
description Cytochrome b5 family, heme-binding domain signature.[FY]-[LIVMK]-{I}-{Q}-H-P-[GA]-G.
source prosite : PS00191

76) chain A
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA1

77) chain A
residue 143
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1fcb
source CSA : CSA1

78) chain A
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA1

79) chain A
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA1

80) chain A
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA1

81) chain B
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

82) chain B
residue 143
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

83) chain B
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

84) chain B
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

85) chain B
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA2

86) chain A
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA3

87) chain A
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA3

88) chain A
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA3

89) chain A
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA3

90) chain B
residue 254
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

91) chain B
residue 376
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

92) chain B
residue 373
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4

93) chain B
residue 282
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1fcb
source CSA : CSA4


Display surface

Download
Links