eF-site ID 1lbe-A
PDB Code 1lbe
Chain A

click to enlarge
Title APLYSIA ADP RIBOSYL CYCLASE
Classification HYDROLASE
Compound ADP RIBOSYL CYCLASE
Source ORGANISM_COMMON: California sea hare; ORGANISM_SCIENTIFIC: Aplysia californica;
Sequence A:  IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKD
FFKAFSFKNPCDLDLGSYKDFFTSAQQQLPKNKVMFWSGV
YDEAHDYANTGRKYITLEDTLPGYMLNSLVWCGQRANPGF
NEKVCPDFKTCPVQARESFWGMASSSYAHSAEGEVTYMVD
GSNPKVPAYRPDSFFGKYELPNLTNKVTRVKVIVLHRLGE
KIIEKCGAGSLLDLEKLVKAKHFAFDCVENPRAVLFLLCS
DNPNARECRL
Description (1)  ADP RIBOSYL CYCLASE


Functional site

1) chain A
residue 98
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1r16
source CSA : CSA1

2) chain A
residue 179
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1r16
source CSA : CSA1


Display surface

Download
Links